PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_020497-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family SAP
Protein Properties Length: 342aa    MW: 37482.7 Da    PI: 5.8792
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_020497-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP406.92.2e-1241341121454
              SAP 121 tarnfrtrrysyvtlqfdp.....advdedndadalsCrclalsdkylaaGfadGavrlfdletrlhvstflpqhrdrlGrfsravsGivisds 209
                      +arnfr  rysy+ l  ++     a+  ++ ++   +C +l ls+ +laaGf+dG+vrlf+l +r+h++t++p  rd+lG+fs+avsGiv++  
  AHYPO_020497-RA   1 MARNFRISRYSYFILYPSDhplaaAQGGDEGNQLPILCLRLVLSEDHLAAGFSDGSVRLFHLPSRQHIRTIHPLLRDHLGHFSHAVSGIVLQPV 94 
                      69**********9875433111103333334445579******************************************************974 PP

              SAP 210 ..rlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGrafhiWdaeteelvfvGGsltdPeavmGWhmltel 301
                        r+vfa+ldG ihva   g g +aar+a++GdvvndGal+df+Gs+r+wvGlyaGvpGraf++Wda++eel f+G sltdPe+vmGW mlte+
  AHYPO_020497-RA  95 idRIVFASLDGYIHVASPLG-GPSAARQAYVGDVVNDGALIDFTGSDRFWVGLYAGVPGRAFRVWDADSEELLFMGISLTDPESVMGWRMLTEI 187
                      349*************9877.899********************************************************************** PP

              SAP 302 ..telvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvdsrGvatvrrvenleevcrfrvrgaqrgvlgCv 393
                        telvGr+r++ +  av  t+lr +v+ + ++  v++e+ +rrG+iv+s+da+nea+v+vds+G a+vr   +leevcrf+v+   +++lgC+
  AHYPO_020497-RA 188 rpTELVGRIRISPQGLAVGVTRLRAMVLGIEEPVTVVGEQPSRRGIIVGSVDANNEAFVIVDSHGLASVRYLRTLEEVCRFSVSLRGGELLGCM 281
                      666*********************************************************************************999******* PP

              SAP 394 nggyalvyaggvlrvWeiekkegylyslrervgevnalvaddrhvavsssdgtihlldfga 454
                      n+ y+++++gg +r+++ e+ e ylys+re v+e+  l a++rhv ++ssd++ihl+dfga
  AHYPO_020497-RA 282 NNMYVMMCTGGTIRAYDAEHGE-YLYSFREWVEEATDLAANNRHVVAASSDSSIHLWDFGA 341
                      *******************976.************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003202.31861IPR001680WD40 repeat
Gene3DG3DSA:2.130.10.105.8E-1531105IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509782.85E-1834173IPR017986WD40-repeat-containing domain
SMARTSM0032018064111IPR001680WD40 repeat
Gene3DG3DSA:2.130.10.105.8E-15154166IPR015943WD40/YVTN repeat-like-containing domain
Gene3DG3DSA:2.130.10.105.8E-15213339IPR015943WD40/YVTN repeat-like-containing domain
SuperFamilySSF509782.85E-18230338IPR017986WD40-repeat-containing domain
SMARTSM003202.1301338IPR001680WD40 repeat
PROSITE profilePS500829.172321341IPR001680WD40 repeat
PROSITE patternPS006780325339IPR019775WD40 repeat, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MARNFRISRY SYFILYPSDH PLAAAQGGDE GNQLPILCLR LVLSEDHLAA GFSDGSVRLF  60
HLPSRQHIRT IHPLLRDHLG HFSHAVSGIV LQPVIDRIVF ASLDGYIHVA SPLGGPSAAR  120
QAYVGDVVND GALIDFTGSD RFWVGLYAGV PGRAFRVWDA DSEELLFMGI SLTDPESVMG  180
WRMLTEIRPT ELVGRIRISP QGLAVGVTRL RAMVLGIEEP VTVVGEQPSR RGIIVGSVDA  240
NNEAFVIVDS HGLASVRYLR TLEEVCRFSV SLRGGELLGC MNNMYVMMCT GGTIRAYDAE  300
HGEYLYSFRE WVEEATDLAA NNRHVVAASS DSSIHLWDFG A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010689285.10.0PREDICTED: transcriptional regulator STERILE APETALA
SwissprotQ9FKH11e-106SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLA0A0J8BLF10.0A0A0J8BLF1_BETVU; Uncharacterized protein
STRINGPGSC0003DMT4000484861e-107(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-107SAP family protein